PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P10390_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 232aa    MW: 26717.2 Da    PI: 6.9456
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P10390_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.3e-1885139256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++t eq++ Le+ F+  ++++++++++LA++l++  rqV vWFqNrRa+ k
  GSMUA_Achr1P10390_001  85 RKKLKLTIEQVRLLEDSFRHRSTLNTTQKQDLAHRLNIRPRQVEVWFQNRRARTK 139
                            678899***********************************************98 PP

2HD-ZIP_I/II113.11.8e-3685174190
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk++l+ eqv+lLE+sF+++++L++++K++la++L+++prqv+vWFqnrRARtk+k++E dye L+ ++d+l +en+rL+ke +eLr
  GSMUA_Achr1P10390_001  85 RKKLKLTIEQVRLLEDSFRHRSTLNTTQKQDLAHRLNIRPRQVEVWFQNRRARTKLKRIELDYECLRMHCDRLIDENRRLKKELQELR 172
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 ee 90 
                            ++
  GSMUA_Achr1P10390_001 173 SA 174
                            75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-1670139IPR009057Homeodomain-like
SuperFamilySSF466891.09E-1673140IPR009057Homeodomain-like
PROSITE profilePS5007116.40681141IPR001356Homeobox domain
SMARTSM003894.1E-1383145IPR001356Homeobox domain
CDDcd000861.87E-1285139No hitNo description
PfamPF000464.4E-1585139IPR001356Homeobox domain
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
SMARTSM003401.2E-9141184IPR003106Leucine zipper, homeobox-associated
PfamPF021833.1E-7141173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEEGDCNTSL SLAIGGGRQF TPSTSLHVLF PHHPKQEEEE EEDTHRHVGS VSRWKELDEE  60
EEEEDGVSGK DDSSNLSDDK PVGTRKKLKL TIEQVRLLED SFRHRSTLNT TQKQDLAHRL  120
NIRPRQVEVW FQNRRARTKL KRIELDYECL RMHCDRLIDE NRRLKKELQE LRSATPASPF  180
YVQLLEAATL IMCPACERIA AAGKRKSSAL EDGMKRPPQL VPVNTALLRL QN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009386832.12e-82PREDICTED: homeobox-leucine zipper protein HAT22-like
TrEMBLM0RYP81e-172M0RYP8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P10390_0011e-171(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-46homeobox from Arabidopsis thaliana